Transcription

View metadata, citation and similar papers at core.ac.ukbrought to you byCOREprovided by Cokroaminoto Palopo University Journals / Jurnal Elektronik Universitas Cokroaminoto.Prosiding Seminar NasionalISSN 2443-1109Volume 04, Nomor 1IDENTIFIKASI SENYAWA METABOLIT SEKUNDER EKSTRAK BUAHDENGEN (Dillenia serrata)Ilmiati Illing 1 , Maria Lydiana Jelita2Universitas Cokroaminoto Palopo 1,[email protected] mail.co m1AbstrakPenelitian ini bertujuan untuk mengetahui komponen senyawa metabolit sekunder yang terkandungpada ekstrak Buah Dengen (Dillenia serrata). Hasil uji skrining fitokimia menunjukkan bahwa ekstraketanol Buah Dengen positif mengandung alkaloid, flavonoid, saponin, polifenol dan terpenoid.Selanjutnya dilakukan identifikasi senyawa metabolit sekunder dengan Gas Chromatography-MassSpectroscopy (GC-MS). Senyawa metabolit sekunder yang teridentifikasi adalah golongan flavanoid,yaitu senyawa 4H-Pyran-4-one,2,3dihydro-3,5-dihydroxy-6-methyl dan beberapa golongan lain yaitusenyawa asam organik dan furan.Kata kunci: buah dengen, metabolit sekunder, GCMS1. PendahuluanDengen merupakan salah satu buah lokal dari Sulawesi Selatan. Dengen tersebarluas di Kabupaten Luwu. Tanaman Dengen tumbuh liar di hutan dan pekaranganmasyarakat. Kekhasan yang dimiliki oleh buah dengen ini terutama adalah pada rasaasam yang menyegarkan dan warna buah yang menarik. Selain penampilannya yangeksotik, buah dengen mengandung vitamin C lebih dari 84% yang baik dikonsumsioleh tubuh (Nur ilma, 2012).Buah dari tanaman ini belum dibudidayakan secara resmi karena keberadaannyayang dialam liar dan belum banyak di gunakan, karena rasanya yang masammasyarakat lokal pun hanya sebagian yang menyukai buah dengen tersebut.Pemanfaatannya juga belum optimal karena hanya beberapa masyarakat lokal sajayang mampu menikmati. Oleh karena itu, pada penelitian ini dilakukan identifikasisenyawa metabolit sekunder dari ekstrak buah dengen sehingga buah dengen tidakhanya digunakan sebagai pemberi citra rasa makanan tetapi juga di gunakan sebagaiobat, sumber energi dan sebagainya.Tujuan Dan Manfaat PenelitianTujuan dari penelitian ini adalah mengetahui komponen senyawa metabolit sekunderyang terkandung pada ekstrak Buah Dengen (Dillenia serrata) menggunakan ujifitokimia dan GC-MS.Tinjauan Umum Buah Dengen (Dillenia serrata)Dengen termasuk tumbuhan endemik yang berasal dari Sulawesi Selatan.Cirikhas dari buah tersebut berbentuk mahkota berwarna kuning, setengah mirip telingabila di belah dengan helaian buahnya.Masyarakat setempat dulunya menggunakanHalaman 260 dari 451

Ilmiati Illing, Maria Lydiana Jelitabuah ini untuk memberikan cita rasa asam untuk masakan mereka. (Nur ilma,2012).Dengen (Dillenia serrata) adalah buah yang banyak tumbuh di wilayah Luwu.Bentuk ukuran, dan rasa buah dengen hampir sama dengan jeruk. Jika sudah matangkulit buah akan terbuka sendiri layaknya kelopak bunga. Meski sudah masak, dengenterasa sangat masam bila dimakan secara langsung.Tanaman ini termasuk tumbuhan yang bisa hidup bertahun-tahun. Habitatpohon buah dengen ini adalah hutan. Buah dengen adalah nama untuk daerah selawesiselatan sedangkan nama ilmiah dari buah dengen yaitu buah simpur. Buah dengen inimengandung asam sitrat yang sangat tinggi, sehingga rasanya masam sekali. Secarakimia, apabila buah ini dihancurkan dan dicampur dengan air, maka asam tersebutakan terionisasi menjadi ion hidrogen dan ion sisa asamnya bermuatan negatif(Hasrianti, 2012).Metabolit SekunderMetabolit sekunder adalah senyawa organik yang dihasilkan tumbuhan yangtidak memiliki fungsi langsung pada rotein,pertumbuhan atau respirasi,asimilasi nutrient,diferensiasi,pembentukan karbohidrat, protein, dan lipid. Metabolit sekunder umumya hanyadijumpai pada satu spesies atau kelompok spesies, berbeda dari metabolit primer(asam amino, nukleotida, gula, dan lipid) yang dijumpai hampir disemua kingdomtumbuhan (Mastuti, 2016).Senyawa metabolit sekunder yang umum terdapat pada tanaman adalah :alkaloid, flavanoid, steroid, saponin, terpenoid dan tanin. Harborne (1996). Beberapasenyawa metabolit sekunder yang terdapat pada ekstrak alami tanaman yaitu alkaloid,terpenoid, saponin, polifenol,flavonoid dan steroid.EkstraksiEkstraksi adalah kegiatan penarikan kandungan kimia yang dapat larut sehinggaterpisah dari bahan yang tidak dapat larut dengan pelarut cair. Dan hasil dari ekstraksiadalah ekstrak. Ekstrak adalah sediaan kental yang diperoleh dengan mengekstraksisenyawa aktif dari simplisia nabati atau simplisia hewani menggunakan pelarut yangsesuai, kemudian semua atau hampir semua pelarut diuapkan dan massa atau serbukyang tersisa diperlakukan sedemikian hingga memenuhi baku yang telah ditetapkan(Sampurno, 2000).Ekstraksi adalah penyarian zat-zat berkhasiat atau zat-zat aktif dari bagiantanaman obat, hewan dan beberapa jenis ikan termasuk biota laut. Zat-zat aktifHalaman 261 dari 451

Identifikasi Senyawa Metabolit Sekunder Ekstrak Buah Dengen (Dillenia Serrata)terdapat di dalam sel, namun sel tanaman dan hewan berbeda demikian pulaketebalannya, sehingga diperlukan metode ekstraksi dengan pelarut tertentu dalammengekstraksinya.Ekstraksi ini didasarkanpadaprinsipperpindahanmassakomponen zat ke dalam pelarut, dimana perpindahan mulai terjadi pada lapisan antarmuka kemudian berdifusi masuk ke dalam pelarut (Hudaya. A, 2010).FitokimiaFitokimia merupakan ilmu pengetahuan yang menguraikan aspek kimia suatutanaman. Menurut Moelyono (1996) analisis fitokimia merupakan bagian dari ilmufarmakognosi yang mempelajari metode atau cara analisis kandungan kimia yangterdapat dalam tumbuhan atau hewan secara keseluruhan atau bagian-bagiannya,termasuk cara isolasi atau pemisahannya. Menurut Robinson (1991) alasan lainmelakukan fitokimia adalah untuk menentukan ciri senyawa aktif penyebab efekracun atau efek yang bermanfaat, yang ditunjukan oleh ekstrak tumbuhan kasar biladiuji dengan sistem biologis. Pemanfaatan prosedur fitokimia telah mempunyaiperanan yang mapan dalam semua cabang ilmu tumbuhan. Meskipun cara inipenting dalam semua telaah kimia dan biokimia juga telah dimanfaatkan dalam kajianbiologis.Gas Chromatography-Mass Spectroscopy (GC-MS)Gas Chromatography-Mass Spectroscopy (GC-MS) merupakan suatu gabungandari instrumen GC dan instrumen MS.Kedua alat dihubungkan dengan satu interfase.Informasi yang diperoleh dari kedua teknik ini yang digabung dalam instrumen GCMS adalah tidak lain hasil dari masing-masing spektra. Untuk spektra GC, informasiterpenting yang didapat adalah waktu retensi untuk tiap-tiap senyawa dalam sampel.Sedangkan untuk spektra MS, bisa diperoleh informasi mengenai massa molekulrelatif dari senyawa sampel tersebut(Pavia et al., 2001).2. Metode PeelitiannAlat dan BahanAlat-alat yang akan digunakan dalam penelitian ini adalah pisau, baskom,erlenmeyer, neraca analitik, alat destilasi, blender, corong, spatula, batang pengaduk,gelas kimia, pipet tetes, gelas ukur, gelas kimia, plat tetes dan spektroskopi GC-MS,Bahan yang akan digunakan dalam penelitian ini yaitu kulit buah dengen,akuades, etanol 96%, HCl 2 N, serbuk Mg, HCl pekat, FeCl3 , pereaksi Mayer danHalaman 262 dari 451

Ilmiati Illing, Maria Lydiana JelitaWagner, pereaksi Liebermann-Burchard, kertas saring, kertas label, aluminium foil,tissue.Prosedur KerjaSampel buah dengen di timbang sebanyak 300 gram, kemudian di cuci, serta dikupas untuk mengambil daging buahnya kemudian di keringkan. Sebanyak 300 gramsampel dimaserasi menggunakan pelarut etanol 96% selama 3 24 jam pada suhukamar dan terlindung dari cahaya. Setiap 24 jam dilakukan pengadukan danpenggantian pelarut. Penyarian hari ke-3, semua filtrat yang diperoleh kemudiandikumpulkan dan dipekatkan dengan proses destilasi, selanjutnyaekstrak kental ditimbang. Tahap selanjutnya adalah uji fitokimia dan identifikasi senyawa metabolitsekunder dengan menggunakan GC-MS.3. Hasil Dan PembahasanHASIL UJI FITOKIMIABerdasarkan penelitian yang dilakukan, hasil ekstraksi Buah Dengen (Dilleniaserrata) dengan berat serbuk sampel sebanyak 300 gram yang kemudian dimaserasiselama 3 24 jam dengan pelarut etanol 96%. Hasil uji fitokimia dapat dilihat padatabel berikut.Tabel. Hasil uji fitokimiaNo.Uji fitokimia1.AlkaloidPereaksiPerubahan warnaUji mayerTerbentuk endapan putih.Terbentuk endapan jinggasampai merah coklat.KuningTerbentuk busaUji wagnerMg HCl pekatAquades panas HCl pekat4.PolifenolFeCl3Biru kehitaman5.TerpenoidLiebermannTerbentuk cincinBurchardkecoklatan.Sumber: Hasil penelitian di Laboratorium Bahan Alam (2017).2.3.FlavonoidSaponinKet: (-)( )( )Hasil uji Negatif Positif lemah Positif kuatHasil analisis GC-MS ekstrak etanol dari Buah DengenHasil dari analisis terhadap puncak-puncak spektrum dari sampel ekstrak BuahDengen menghasilkan 60 peak. Hal tersebut dapat dilihat pada gambar berikut.Gambar Analisis GC-MS komponen ekstrak Buah Dengen.Halaman 263 dari 451

Identifikasi Senyawa Metabolit Sekunder Ekstrak Buah Dengen (Dillenia rboksilatfuranAsamkarboksilatAsam.karboksilatWaktu retensi (RT) dan % area senyawa metabolit sekunder hasil analisis dariGC-MS dari ekstrak Buah Dengen dapat dilihat pada tabel di bawah ini.Tabel. hasil GCMS berdasarkan luas area ,252/36949.7399,53953.5003,16StrukturNama senyawaPotensiButannoic acid,prolyl esterSebagaiantioksidan, danantibiotic(potter,1980)2Furancarboxaldehyde, 5(hydroxymethyl)-Antioksidan danati an)Halaman 264 dari 451(win,2005)

Ilmiati Illing, Maria Lydiana ,3 dihydro3,5-dihydroxy6-methyAnti microbadan anti(flavanoid)(Ehsan, O., at,al)2furancarboxaldehydePelarut danpembuatanbahan bakukimia dan bahanbaku an Tabel di atas puncak 31dengan membutuhkan waktu retensi8.248 menit dengan kemiripan 93 yaitu methyl termasuk kedalam golongan senyawa Flavanoid.Flavanoidmerupakan salah satu komponen kimia yang sering dilaporkan memiliki aktivitasfarmakologi terhadap pengobatan atau pencegahan penyakit. Flavonoid termasuksenyawa fenolik alam yang potensial sebagai antioksidan dan mempunyai bioaktivitassebagai obat hal ini sesuai dengan penelitian Florentina, et al., 2006. Analisiskuantitatif flavonoid total ekstrakkulit kayu Dengen mengandung senyawa flafonoidyang berperan sebagai pengobatan muntah darah. Pada analisis ekstrak buah dengenterdapat juga senyawa flavanoid yaituberupa 4H-pyran-4-one-2,3-dihydro-3,5-dihydroxy-6-methyl yang berperan sebagai antioksidan dan antimikroba hal ini jugasesuai dengan penelitian Ehsan dkk. (2011) yang menyatakan senyawa berupa rigolonganflavonoidmengandung beberapa zat antimikroba. Oleh karena itu melihat berbagai manfaat darikandungan senyawa yang teridentifikasi dalam ekstrak buah dengen seperti amasyarakatdapatmemanfaatkannya sebagai obat herbal alami.4. KesimpulanBerdasarkan hasil penelitian yang telah dilakukan tentang identifikasi senyawametabolit sekunder dari ekstrak etanol Buah Dengen (Dillenia serrata) dapatdisimpulkan bahwa ekstrak etanol Buah Dengen mengandung senyawa alkaloid,Halaman 265 dari 451

Identifikasi Senyawa Metabolit Sekunder Ekstrak Buah Dengen (Dillenia Serrata)flavonoid, saponin, polifenol dan triterpenoid serta mengandung senyawa metabolitsekunder berupa 4H-Pyran-4-one,2,3 dihydro-3,5-dihydroxy-6-methylDaftar Pustaka[1]H. Alrasyid. Pedoman Pengelolaan Hutan nipah (Nypa Fructicans) SecaraLestari. Puslitbang Hutan dan Konservasi Alam. Badang Litbang Kehutanan.Depatemen Kehutanan. Bogor, 2001.[2] Ehsan, O., Norhani, A., Syahida, A., Wan, Z.S., Abdul, R.O. Dan Yin, W.H.(2011). Bioactive Compounds And Biological Activities Of Jatropha Curcas L.Kernel Meal Extract. International Journal Of Molecular Science 12:59555970.[3] Florentina, Mulyati.Tahan Dan Himma. Pemanfaatan Tumbuhan SebagaiBahan Obat.Pusat Penelitian Biologi. Bogor. Hal333-339. 2006.[4] Harborne, J. B. 1996. Metode Fitokimia Penuntun Cara Modern MenganalisisTumbuhan. Penerbit Itb. Bandung[5] Hasrianti. 2012. . Studi Pembuatan Permen Buah Dengen. Program Studi IlmuDan Teknologi Pangan, Jutusan Teknologi Pertanian Fakultas Pertanian.Universitas Hasanuddi Makasar.[6] Hudaya. A. 2010. Uji Antioksidan Dan Antibakteri Ekstrak Air BungaKecombrang (Etlingera Elatior) Sebagai Pangan Fungsional TerhadapStaphylococcus Aureus Dan Escherichia Coli. Skripsi. Universitas Islam NegeriSyarif Hidayatullah. Jakarta.[7] Mastuti, R. 2016. Metabolit Sekunder Dan Pertahanan Tumbuhan. JurusanBiologi, Fmipa Universitas Brawijaya. Malang[8] Nur Ilma, 2012.Studi Pembuatan Dodol Buah Dengen (Dillenia SerrataThunb).Teknologi Pangan, Fakultas Pertanian. Universitas HasanuddinMakasar[9] Pavia, D.L., G.M. Lampman, And G.S. Kris. 2001. Introduction ToSpectroscopy: A Guide For Students Of Organic Chemistry (ThirdEdition).Thomson Learning.Washington.[10] Potter. 1980. Identifikasi Dan Isolasi Senyawa Kimia Dari Mangrove (HutanBakau). Laporan Hasil Penelitian Pusat Penelitian Kawasan Pantai Dan PerairanUnuversitas Riau. Hal 18.[11] Sampurno. 2000. Parameter Standar Umum Ekstrak Tumbuhan Obat.Departemen Kesehatan. Jakarta[12] Win, David Tin. 2005. Furfural-Gold From Garbage. Faculty Of Science AndTechnology, Assumption University Bangkok, Thailand.Halaman 266 dari 451

mengekstraksinya. Ekstraksi ini didasarkan pada prinsip perpindahan massa komponen zat ke dalam pelarut, dimana perpindahan mulai terjadi pada lapisan antar muka kemudian berdifusi masuk ke dalam pelarut (Hudaya. A, 2010). Fitokimia Fitokimia merupakan ilm